SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4F789 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4F789
Domain Number 1 Region: 88-193
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 0.000000041
Family Deoxycytidylate deaminase-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B4F789
Sequence length 224
Comment (tr|B4F789|B4F789_RAT) Apolipoprotein B mRNA-editing enzyme catalytic subunit 2 {ECO:0000313|Ensembl:ENSRNOP00000016893} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=rCG_43450 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MAQKEEAAEAAAPASQNGDDLENLEDPEKLKELIDLPPFEIVTGVRLPVNFFKFQFRNVE
YSSGRNKTFLCYVVEAQSKGGQVQATQGYLEDEHAGAHAEEAFFNTILPAFDPALKYNVT
WYVSSSPCAACADRILKTLSKTKNLRLLILVSRLFMWEEPEVQAALKKLKEAGCKLRIMK
PQDFEYLWQNFVEQEEGESKAFEPWEDIQENFLYYEEKLADILK
Download sequence
Identical sequences B4F789
10116.ENSRNOP00000016893 ENSRNOP00000016893 NP_001100353.1.100692 NP_001100353.1.4139 ENSRNOP00000016893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]