SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B4G3V6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4G3V6
Domain Number 1 Region: 6-48
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.00000000000000445
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B4G3V6
Sequence length 177
Comment (tr|B4G3V6|B4G3V6_DROPE) GL24482 {ECO:0000313|EMBL:EDW25061.1} KW=Complete proteome; Reference proteome OX=7234 OS=Drosophila persimilis (Fruit fly). GN=Dper_GL24482 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MALCQTSVLKVYHAVIEDVITNVRDAFLDEGVDEQVLQEMKQIWRNKLLASKAVELTPDP
SEGSHPPPIVANNPKVSKVCDRCLPTFDVDPCVHSRHIRSSSSTAAMAAKSPAAGAAAAG
SGLKNGQMPIKQEVTSQNPPPLHPTSGGSIAQRQQASGGGQTPIPLWPRWTPTASCP
Download sequence
Identical sequences B4G3V6
XP_002014075.1.64850 FBpp0188589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]