SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B4JAI4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4JAI4
Domain Number 1 Region: 205-495
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 2.88e-97
Family Cryptochrome/photolyase FAD-binding domain 0.00000624
Further Details:      
 
Domain Number 2 Region: 7-218
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 3.79e-47
Family Cryptochrome/photolyase, N-terminal domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B4JAI4
Sequence length 538
Comment (tr|B4JAI4|B4JAI4_DROGR) GH10854 {ECO:0000313|EMBL:EDW02770.1} KW=Complete proteome; Reference proteome OX=7222 OS=Drosophila grimshawi (Fruit fly) (Idiomyia grimshawi). GN=Dgri_GH10854 OC=Ephydroidea; Drosophilidae; Drosophila; Hawaiian Drosophila.
Sequence
MTAQRRTLVHWFRKGLRVHDNPALFQIFEVARAAPEKFYVRPIFILDPGILDWMQVGANR
WRFLQQSLSDLDQQLRALNTRLFVVRGKPVDIFPGLFERWQVQLLTYETDIEPYAVLRDA
AVQQLAASQGVKVDTHCSHTIYNPELVIVRNLGKPPITYQKFLGIVEKLKLPKVLNKPKK
LPDGMQPLADSDIYDYPTLEQLVKRPEDLGINKFPGGESEALRRMEASLADEQWVAKFEK
PKTAPNSLEPSTTVLSPYLKFGCLSARLFHERLQEILARQPKHSKPPVSLVGQLLWREFY
YTVAAAEPNFDRMLGNAYCLQIPWQEQPEHLEAWAHGRTGYPFIDAIMRQLRQEGWIHHL
ARHAVACFLTRGDLWISWEEGQRVFEQLLLDQDWALNAGNWMWLSASAFFHQYFRVYSPV
AFGKKTDPKGDYIKKYVPELAKYPAKCIYEPWKATLGEQRDYGCVLGSDYPHRIVNHDVV
HKENIKRMSDAYKVNREVRTGKQEEGHEEEEEYEEHPTGKRKASSKVTGSKLKHKLLK
Download sequence
Identical sequences B4JAI4
7222.FBpp0144760 XP_001987903.1.65300 FBpp0144760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]