SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B4N4K4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4N4K4
Domain Number 1 Region: 320-439
Classification Level Classification E-value
Superfamily TPR-like 2.14e-16
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B4N4K4
Sequence length 477
Comment (tr|B4N4K4|B4N4K4_DROWI) Uncharacterized protein {ECO:0000313|EMBL:EDW79078.1} KW=Complete proteome; Reference proteome OX=7260 OS=Drosophila willistoni (Fruit fly). GN=Dwil_GK12366 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSNLSEYFANDPPSFFDELTPTKPNTKEQEPEPRPSGGSTMLSSGFTGGFQPPEYVEITE
TDDGGIKVSEDVRNFWELPSEQNKLIMPGIHIQGDLPDPIAIAVSQHLDEAELQHRKILC
VDDVTQDERGLKMLIHASCFRSAVNLSGRLLTIYGQGYGRSGQPAKHSPHSLQLWFTRLA
LLAKLGEYELLQAEAEPFGSHLNGPDVFFEHYPEMYNGKTGSIACFSFRLLIAELPTYLG
KPHLALDRLSELYVTCKEIREHFIALNDSPAGEFWLIRGEMVLHSIVNCALMMKKFSMID
DIISGILLTRSSLTKDEQRSLYSAWGRIYLQIGDIFGAEQKFAVARRLREMNSNPDLRDL
VDKGLIAVAKNDFPEAYLIFQKALHLDSGNTMILNNMGVCLLYAGKLKDAITLYERAINL
NPQKSLNESLLVNLSTLYELESNNSKTKKLNLLRLINRFKPDLNISIEICLKLQAGN
Download sequence
Identical sequences B4N4K4
7260.FBpp0241509 XP_002068092.1.14588 FBpp0241509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]