SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B4NAU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4NAU6
Domain Number 1 Region: 847-975
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.53e-37
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1159-1248
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.62e-26
Family Ras-binding domain, RBD 0.0025
Further Details:      
 
Domain Number 3 Region: 34-118
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-19
Family PDZ domain 0.0065
Further Details:      
 
Domain Number 4 Region: 1105-1172
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000251
Family Ubiquitin-related 0.075
Further Details:      
 
Domain Number 5 Region: 238-326,356-376
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000404
Family Phosphotyrosine-binding domain (PTB) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B4NAU6
Sequence length 1598
Comment (tr|B4NAU6|B4NAU6_DROWI) Uncharacterized protein {ECO:0000313|EMBL:EDW80910.2} KW=Complete proteome; Reference proteome OX=7260 OS=Drosophila willistoni (Fruit fly). GN=Dwil_GK11781 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MPPVSVSASSTPPVASTSAIAQQQHQRRRKKRPNYNYNGTRTVDVRRGYNGFGFTISGQQ
PCRLSCIISNSPAEQAGLRSGDFLISVNGLNVSKLPHETVVQLIGNSFGSIRMQIAENYY
SDSSDEENAHANPLLLQRSARGQLVAASLRHKPRFLHHKSKMNRLRNSPQKKPPPSAAAD
AAHEDADESKQRSTLPLRPVLEDAPLVQLAKVCAGSGQADVANVSAMVRVVGSAALEYRV
IVGYLGTIEMPKQISHSSKLQTVRSCIRKLRQEKRQPTIVLMGITPDSLTLQSSNGSALA
TYASSRLNYVSSSSESENRFFGLVTSAIHNTQIEEEYEAFNAGGVGGGGGGGGNGGHISI
SHSCHVFVIDTKLIEHGQHIQRAHEFHLECTRDPISNLCLEFPNNSEYVVNLIRSMYTMR
ILPPASRGHQSECEVGGAGGGGVIGAGGAAAHSPQPSNHSEMSTTTSNSDSGIGFNNDCT
NISDRIVVVDFLGNGGGAAAQGVQHPAVGHGLPAPARPQGIVGIPDNRLTVRAMPDLGPN
SPPPSTSSLRRPNLLASFNLIKSPATNLTATRSCDDVLNLLMDNDDDLPSVSALTAVASM
DDISLHSAAPSLDDHETRDIHFVHPSCVPRKMRRSLAIETTPSSSTTTPHKLSVQVFGKP
GSRHSLGFEAIDIIQSSTSHTHNIMDNMDTWTSLQNIHKAAHQDRISSTTSDTNCLLEAT
NSEPDLGNRALPANASPFRRAWGQSSFRTPRTDKVAKQQQQLQQQGQQKHNSPLVRRTAS
MNASDNDVYIKTLMLDAERKAATSRSFLQVPQILTTPAPPSVHAVTVDVLAQDTTPSIPP
PDATTANTTGTPSQWGTSFERMLQDAAGMQTFAEFLKKEFSAENIYFWTACERYRLIESE
AERSSVAREIFAKHLANSSSDPVNVDSQARNLTEENLASAAADIFAPAQKQIFNLMKFDS
YQRFIRSDLYKSCVEAEQKGQPLPYNGANLDDLLKTNFHLVASSKLKKSASNAEDRRRKS
LLPWHRKTRSKSRDRSELMSDLQNSLMPAPPLPPPPPGLLSSASLKLTSNQNSLSDLHSS
RSSLSSFDAGGACGATASAESVCSLCRVILSDGATTIVQTRPGETVSQLVDRLLEKRNLV
YPYYDIVFQGTTKSIDTQQPSQILAGKEVVIERRVAFKLDLPDPKVISVKSKPKKHLHEV
IRPILTKYNYKMDGVVVLMRDTQMPLDLMQPVTIADGHRLQIVMRQSDFQPGGGNIVPPK
LTKPMKPLPPSATTTSSSQGQLDELTNKVFNELLQNKAADAAAADRKKSSDLCSIKSNDA
PSESSSSLFGMRRHQRNNTANIPSSKLPKLKKKSTSSSQHSEEALPATGTTAATLPADPK
KPIIAKLKAGVKLQVTERVAEHQDELLEGLKRAQLARLEDQRGTEINFDLPDFLKNKENL
NAAASKLRKVRANLSPISKTSPQTAEGLPQPAPRFSIARSQSQQQVSPMKVDLEQETDLP
ADMQDPNEFTKAPPPLPPKPKVLPIKPSNWGVASQPTTGNYCNKFSPTKQTPISPTKTTG
SSSGPFANKLPIDNMARKSLESAGTRCAYLDEPSSSFV
Download sequence
Identical sequences B4NAU6
XP_002069924.2.14588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]