SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4QYH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4QYH6
Domain Number 1 Region: 6-254
Classification Level Classification E-value
Superfamily CutC-like 1.83e-60
Family CutC-like 0.00000745
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B4QYH6
Sequence length 259
Comment (tr|B4QYH6|B4QYH6_DROSI) GD20351 {ECO:0000313|EMBL:EDX12821.1} KW=Complete proteome; Reference proteome OX=7240 OS=Drosophila simulans (Fruit fly). GN=Dsim_GD20351 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSTHDIKLEVCVDSIRSAFAAEDGGASRIELCSALGEGGLTPSVGTLKTIKETLTIPIYC
MLRPRRGTDFVYSDEEMCALLTDMDLLRENGADGFVFGSLNPDRSINVDQCRHVLLASGG
LPVTFHRAFDLTDQKSMDENVDMLRELGFRRLLSSGFRPTAADGVDCLAQLIAKHQRDFI
VMPGAGIKVSNLEEILTVSRCLEFHASALDTAGEDYVAPTTTRMECDVTMGKQDVDPYYG
TNSIVVRKMVTIAKAMSSR
Download sequence
Identical sequences B4QYH6
XP_002103318.1.80810 FBpp0218753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]