SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B4RLJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4RLJ1
Domain Number 1 Region: 25-99
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.0000497
Family Duplicated SiR/NiR-like domains 1 and 3 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B4RLJ1
Sequence length 105
Comment (tr|B4RLJ1|B4RLJ1_NEIG2) Sulfite reductase hemoprotein, beta-component {ECO:0000313|EMBL:ACF29678.1} KW=Complete proteome OX=521006 OS=Neisseria gonorrhoeae (strain NCCP11945). GN=NGK_1001 OC=Neisseriaceae; Neisseria.
Sequence
MIKYNREEHKMTVQAKTKGLAWQEKPLSDNERLKTESNFLRGTILDDLKDPLTGGFKGDN
FQLIRFHSMYEQDGRDIRTEAKLEPLKFMLLRCRLPAGSSNRPSG
Download sequence
Identical sequences B4RLJ1
521006.NGK_1001 gi|385335694|ref|YP_005889641.1| gi|194098564|ref|YP_002001626.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]