SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B4SSE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B4SSE1
Domain Number - Region: 87-142
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00131
Family NfeD domain-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B4SSE1
Sequence length 147
Comment (tr|B4SSE1|B4SSE1_STRM5) Uncharacterized protein {ECO:0000313|EMBL:ACF52773.1} KW=Complete proteome OX=391008 OS=Stenotrophomonas maltophilia (strain R551-3). GN=Smal_3074 OC=Stenotrophomonas maltophilia group.
Sequence
MRWEVVGWGALALLLFAAEALAPGAFMLWIGIGAAAVFVLVAVFGDIPLLWQVVAFVLLS
VVSIQCYRRWGRPRARPSDAPLLNRRTEQLIGRVVALQQGIVDGHGRVSIDDASWQVTGP
ELPAGAWVKVLSVQGTVLVVEAAGRPL
Download sequence
Identical sequences A0A2J0UM55 B4SSE1 M5D1L6
391008.Smal_3074 WP_006385101.1.100705 WP_006385101.1.41422 WP_006385101.1.52398 gi|194366846|ref|YP_002029456.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]