SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B4V5D6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4V5D6
Domain Number 1 Region: 7-273
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.32e-77
Family Protein kinases, catalytic subunit 0.000000036
Further Details:      
 
Domain Number 2 Region: 523-585
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000222
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0063
Further Details:      
 
Domain Number 3 Region: 460-518
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000903
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0099
Further Details:      
 
Weak hits

Sequence:  B4V5D6
Domain Number - Region: 392-453
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000288
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.011
Further Details:      
 
Domain Number - Region: 593-651
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0144
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B4V5D6
Sequence length 675
Comment (tr|B4V5D6|B4V5D6_9ACTN) Serine/threonine protein kinase {ECO:0000313|EMBL:EDX23174.1} KW=Complete proteome; Reference proteome OX=465541 OS=Streptomyces sp. Mg1. GN=M444_17915 OC=Streptomyces.
Sequence
MEEPRRLGGRYELSHVLGRGGMAEVYLGHDTRLGRTVAVKTLRADLARDPSFQARFRREA
QSAASLNHPAIVAVYDTGEDYVDNISIPYIVMEYVDGSTLRELLHSGRKLLPERTLEMTT
GILQALEYSHRAGIVHRDIKPANVMLTRTGQVKVMDFGIARAMGDSGMTMTQTAAVIGTA
QYLSPEQAKGEQVDARSDLYSAGCLLYELLSVRPPFIGDSPVAVAYQHVREEPQPPSNFD
PEITPEMDAIVLKALVKDPDYRYQSADEMRADIEACLDGQPVAATASMGAAGYGYPDQGG
YGHQGYDQPTTALRATDSGGQTSMLPPMPPGDNGYGYGDQGGHGGYDQGHGRRPKKSRAS
TILLVLAGVLVLVGAILIGRAVFNGGADNRPNVPKLIGETLEAAQGNANNVGLKVVKEAD
EPCDSQPKGKICSQNPQPDTKLDKGEAIKVKISSGAPKVPVLDVINLTFDNAEKTLKDKG
FQVERKTQESERTAGTVLDQNPKAGTEAEKNSVITLIVAKEVSKTEVPDLTGKTKEEAAK
LLQQANLKLGSTTESDAPAGTAPKTVFQQQFPPGEQLKPGSSVSITVAKAAQTTDVPNLA
GKTVSQARGILAGKGLTFGAVVAGPGDENAKVIISDPPAGTQVPPGTVVNVTTIAGGGGQ
QDGGNGFFGGLTGRR
Download sequence
Identical sequences B4V5D6
WP_008739960.1.4706 WP_008739960.1.735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]