SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B5DEN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B5DEN9
Domain Number 1 Region: 132-226
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 1.44e-35
Family VPS28 C-terminal domain-like 0.00033
Further Details:      
 
Domain Number 2 Region: 25-119
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 6.87e-34
Family VPS28 N-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B5DEN9
Sequence length 228
Comment (sp|B5DEN9|VPS28_RAT) Vacuolar protein sorting-associated protein 28 homolog KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Vps28; OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MFHGIPATPGVGALPCSVAAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALE
KAYIKDCVTPNEYTAACSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKED
RPITIKDDKGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPD
FEGRQTVSQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAFNRFLHS
Download sequence
Identical sequences B5DEN9
ENSRNOP00000019707 ENSRNOP00000019707 10116.ENSRNOP00000019707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]