SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B5DFI8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B5DFI8
Domain Number 1 Region: 4-155
Classification Level Classification E-value
Superfamily UBC-like 4.35e-50
Family UBC-related 0.000000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B5DFI8
Sequence length 223
Comment (sp|B5DFI8|UBE2S_RAT) Ubiquitin-protein ligase S KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Ube2s; OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLF
RMKLLLGKDFPASPPKGYFLTKIFHPNVGPNGEICVNVLKRDWTAELGIRHVLLTIKCLL
IHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGACSTSSGRAEASRDLASGASASS
TDPMTPGVLGGAEGPMAKKHAGERDKKLAAKKKLDKKRALRRL
Download sequence
Identical sequences B5DFI8
10116.ENSRNOP00000022977 NP_001099694.1.100692 NP_001099694.1.4139 ENSRNOP00000022977 ENSRNOP00000022977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]