SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B5EQL5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B5EQL5
Domain Number 1 Region: 91-203
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.97e-19
Family RecO C-terminal domain-like 0.022
Further Details:      
 
Domain Number 2 Region: 7-79
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000497
Family RecO N-terminal domain-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B5EQL5
Sequence length 255
Comment (sp|B5EQL5|RECO_ACIF5) Recombination protein O {ECO:0000255|HAMAP-Rule:MF_00201} KW=Complete proteome OX=380394 OS=ferrooxidans (ATCC 53993)). GN=Lferr_1123; OC=Acidithiobacillaceae; Acidithiobacillus.
Sequence
MTTEPGDRAWVLHHYPYGDTSLIVELFTRTQGRLGVLAKGARRARSALARIEAGRPLWVR
WLGRGELPVLAQAEELGPFLPLNPLQNLSLFYVNELLLRLTQRRDPFPDLFQVYEETIDA
LCSEPGEGWYLRRFERRLLENLGWAPDLAHCAECGRSPDAASSEHWLYQAAHGVFCRAHA
PDAAVAIEAAALVWLRGAMQTRSMPVWNSSLRRCLEQELLVHLGGRPLESRRLLTAYLRR
TQPAMTIQKREEHSE
Download sequence
Identical sequences B5EQL5 B7J9K3 E6QAN7
gi|198283251|ref|YP_002219572.1| WP_012536499.1.13253 WP_012536499.1.28209 WP_012536499.1.49158 WP_012536499.1.50737 WP_012536499.1.90948 gi|218665687|ref|YP_002425834.1| 243159.AFE_1402 380394.Lferr_1123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]