SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B5RLH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B5RLH2
Domain Number 1 Region: 308-518
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.3e-39
Family ABC transporter ATPase domain-like 0.00028
Further Details:      
 
Domain Number 2 Region: 90-297
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0000000000144
Family DNA repair protein MutS, domain III 0.032
Further Details:      
 
Domain Number 3 Region: 710-784
Classification Level Classification E-value
Superfamily SMR domain-like 0.000000405
Family Smr domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B5RLH2
Sequence length 786
Comment (tr|B5RLH2|B5RLH2_BORDL) Endonuclease MutS2 {ECO:0000256|HAMAP-Rule:MF_00092, ECO:0000256|SAAS:SAAS00250893} KW=Complete proteome OX=412419 OS=Borrelia duttonii (strain Ly). GN=BDU_101 OC=Bacteria; Spirochaetes; Spirochaetales; Borreliaceae; Borrelia.
Sequence
MNLRDIKVMQEKYLEKIDFYQILSSVASYVTVSDTVKLLNEQQILKTDREIQEVCSFVNL
IKNLIELDEEYPNYCLESINESIVLLLKKKSRISIEEIKNIILFLKEILRIMFFLEKHEL
KFRGEIDVLKKLLFVDPNLKYLLEFLCKYVDIDELKIKHGVDKRYDEIDFEIRNLNKKIE
KQIKQIINLNANYLSSNLIYYKSGKCTIALKSSFKNRIKGNVISVSSSGETFYVEPNEMI
SENNRLSFLNFEKTHIVFRILQKLSDEIRKHIFILKSLYSNFIYYDSLKSRAIYGIQNQG
IFPKLDGDLNIMNARHPLIKNAKPINFSPLNNRVVVITGPNAGGKTATLKTVALLSAMFQ
FGIPIPVDESSTFKIFDNILVDVGDEQSILNSLSTFSSHMNNIAYILKHATKDSLLIFDE
FCSGTDIEQGQALAIAILEHLIFINAFVIISTHYNALKYFAYTHENVINASMQMDLDKME
PSYKLMFSVPGESFAFSVASKFLVDFNIISRAKNIYESSKTEVNEILARLTEKEREIYLL
EEKIKNKLKFIELKEVEINDIRETLVLRERNLEENLVNEQKEFLKKSRQTLENLVREIKE
EGVCLFKNKKFIADISDNIASKVTKIEMLNQKIATKVEFRVGDKVRVLGSNFSGEIIGVT
KKGFIINTGVFKITVAAVSLEKILYNDRAPRGCEKKFSFSFEQQDDTLNLTVDIRGMRVA
EAINFLGKKIDDMLLKNVSKFEIIHGKGEGLLMEGVHAFLKDITFIKKYYFAHPNDGGVG
KTIVEF
Download sequence
Identical sequences B5RLH2
gi|203284023|ref|YP_002221763.1| 412419.BDU_101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]