SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B5RQN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B5RQN8
Domain Number 1 Region: 38-183
Classification Level Classification E-value
Superfamily CBS-domain pair 7.45e-37
Family CBS-domain pair 0.0013
Further Details:      
 
Domain Number 2 Region: 177-256
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.5e-21
Family CorC/HlyC domain-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B5RQN8
Sequence length 259
Comment (tr|B5RQN8|B5RQN8_BORRA) Hemolysin {ECO:0000313|EMBL:ACH94322.1} KW=Complete proteome OX=412418 OS=Borrelia recurrentis (strain A1). GN=BRE_62 OC=Bacteria; Spirochaetes; Spirochaetales; Borreliaceae; Borrelia.
Sequence
MMFKFFNFKNKKMKYVEGKDSEEKSRFETSLLNNFNSLKETIVKEIMVPRISVIFIDYSV
SKDDILKVVTSSNHSRFPVYKETIDDIIGIIHTKDILLHMWKKDFYDIDLKDIMRKVMFV
PESKKIDSLLKEFQENHVHIAIVVDEYGGISGLVTLEDILEEIVGDIQDEFDNEVDEIVP
LDDGSYLCTARVLIEDLNEKLGLCLPDGDFDTLGGFVYDLFGRIPLKNEKIEYNNLIFTI
KNMHQRNIKVIKISQKEGL
Download sequence
Identical sequences B5RKV8 B5RQN8 W5SGV3 W6TYB9
gi|203283985|ref|YP_002221725.1| 412418.BRE_62 412419.BDU_63 gi|203287528|ref|YP_002222543.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]