SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B5YAB6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B5YAB6
Domain Number 1 Region: 189-441
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.83e-66
Family Pyruvate oxidase and decarboxylase Pyr module 0.037
Further Details:      
 
Domain Number 2 Region: 4-211
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.88e-36
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0072
Further Details:      
 
Domain Number 3 Region: 452-557
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.00000000000000107
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B5YAB6
Sequence length 559
Comment (tr|B5YAB6|B5YAB6_DICT6) Oxoglutarate--ferredoxin oxidoreductase, alpha subunit {ECO:0000313|EMBL:ACI18332.1} KW=Complete proteome OX=309799 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12). GN=DICTH_1571 OC=Bacteria; Dictyoglomi; Dictyoglomales; Dictyoglomaceae; Dictyoglomus.
Sequence
MECKILIGGEAGQGIQTISNILSKYFFRIGYYVFTIESYQSRIRGGHNYSLLRISDKPIY
AIDNEKVDILIALNLETIRLHLNEVKEGGHIFCDESIKTEEFLGDDRIIKIPVKQITQEL
KSKLVENTIFVGALLALSSGDIDEMRKIIAETFKQEYFDINMRALEEGYKYARDLNRSCG
SFLKRGRDNRLLLNGAEAVGFGAMVSGCKFLASYPMTPGTAVMNFIAEHELDFDVVVEQA
EDEIAAINMAIGAFFAGARSMVTTSGGGFALMVEGLSLAGMTETPVVIHIGQRPGPATGL
PTRTEQGDLNFVVHAGHGEFVRYVTAPRDQKDAFYKTIKAFELAEKYQIPSIILTDQYLI
DSKAVIEELNPPSEIKFYRVKADTNYLRHKITEDGVSPFAIPGESEALVITDSDEHDEEG
HITEDLSIRKRMVEKRMKKLNLLLKEIEEPSYFGVENPEIIFIGWGSTYGVIKEGIERLI
REGYPIGHLHFSDVYPIVNEHLEKYKGIKLYTIEQNYQGQFAALLRKETGVDVKRGLVKY
NGFPFYVEEIIKGVKELMG
Download sequence
Identical sequences B5YAB6
gi|206900171|ref|YP_002251386.1| WP_012546964.1.10127 309799.DICTH_1571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]