SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B5ZSQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B5ZSQ0
Domain Number 1 Region: 102-366
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.98e-63
Family D-glucarate dehydratase-like 0.0003
Further Details:      
 
Domain Number 2 Region: 6-119
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.53e-30
Family Enolase N-terminal domain-like 0.000081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B5ZSQ0
Sequence length 387
Comment (tr|B5ZSQ0|B5ZSQ0_RHILW) Mandelate racemase/muconate lactonizing protein {ECO:0000313|EMBL:ACI56928.1} KW=Complete proteome OX=395492 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304). GN=Rleg2_3665 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MTTKLKITAIKPYPVWVGTRNQMLVKVETDSGIFGWGESGLSGREKAVAGAVEHYREFLI
GRDPMQIGRIWQEAYRSQYFEGGRVLQAAISAIDIALHDIKGKALGVPAYELLGGKQRDR
IPTFASTGDEAEGEVAIERARELRAQGWQAIRFFPIGQNNRDIFEPRESIGATAAMLNKA
RQALGDDVVLGIDYHHRLSVAEAASFCNKLGRGVLDFLEEPIRDEAPEAYESLRTMTDIP
FAIGEEFASKWQFLPYIERGIHQFNRLDVCNVGGLTEAMKVAGWSEAHYVDLMPHNPLGP
VCTAATIHLAAAVPNFAWLETRAPEAKLGFDNSDFFPVQPRLDGADYPVSDLPGLGVEVN
EEAIKAESFRFWEAPHLKRRDGSVTNW
Download sequence
Identical sequences B5ZSQ0
gi|209551237|ref|YP_002283154.1| 395492.Rleg2_3665 WP_012559194.1.20038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]