SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B6GE26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B6GE26
Domain Number 1 Region: 6-265
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.61e-76
Family Protein kinases, catalytic subunit 0.00000149
Further Details:      
 
Domain Number 2 Region: 377-439
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000589
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0071
Further Details:      
 
Domain Number 3 Region: 448-507
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000942
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B6GE26
Sequence length 652
Comment (tr|B6GE26|B6GE26_9ACTN) Kinase domain protein {ECO:0000313|EMBL:EEA89479.1} KW=Complete proteome; Reference proteome OX=445975 OS=Collinsella stercoris DSM 13279. GN=COLSTE_02363 OC=Coriobacteriaceae; Collinsella.
Sequence
MAEAQRVLGGRYLLKDKVGNGGMASVFRAQDQVLDRTVAVKIMLPQYAGDATFAARFKQE
AQAAAGLQSPYIVGVYDWGKDGDTYYIVMEYLRGTDLKSGIRSHGALDPKKVAQIGSQIC
GALSVAHKHEIIHRDIKPQNIMVLPDGNIKVMDFGIARAKNSHLTQDNNVLGTAHYVSPE
QTRGQDLGPTSDIYSLGVVMYECATGRVPFDGDDAISVALKQVNELPVPPSQVNPGVDPA
LERIILKCMEKDAANRFQTADELREVLNAYAAGRAVDVAEPTHVIAGAVPMGGMGGTETR
VMGDATQAMIRPADGAPGSTAAGPRMGVPSPGTRNGNYEEPKKSNRGKIAAAVIGVIAVI
AAIAIFASGLFGDSKMVTVPNVINYTKDEAEKTLEAAGFEVEYGTPVTDEEVEKGNVVDQ
TPDGNREAKEGSTVKLILSKGPEPTEQVEVPNLTNMTREEAESTLTSLNLKAQVHEEANE
ADEGKVFKQGTNTGEMVDEGSTIEIWVSTGPDTVDVPAITGYTEYDATAALDKAGLAYKV
AYDYSDSVGSGLVISYNPGGNVAPGTVIEIVVSQGPKPVEKVNAPYYVGESAATAARDLK
ALGFAVTIQGPADGVVTAQSASGSLNKGASITLTTQAANSGGDGEGTESGED
Download sequence
Identical sequences B6GE26
WP_006721986.1.1199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]