SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B6GXT2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B6GXT2
Domain Number 1 Region: 19-174
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.8e-31
Family N-acetyl transferase, NAT 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B6GXT2
Sequence length 199
Comment (tr|B6GXT2|B6GXT2_PENRW) Pc12g15550 protein {ECO:0000313|EMBL:CAP81182.1} KW=Complete proteome; Reference proteome OX=500485 OS=Wisconsin 54-1255) (Penicillium chrysogenum). GN=Pc12g15550 OC=Penicillium chrysogenum species complex.
Sequence
MSNASDLRYVRYDNSRENEYVAAMRQLISKDLSEPYSIYVYRYFLYQWGDLCFLAMDDKD
EMVGVVVSKLEPHRDGPLRGYIAMLAVREENRGRGIATKLVRMAIDAMIERDADEIVLET
EITNTGAMKLYERLGFLRSKQLHRYYLNGNSAYRLVLYLKEGVGSIRTTFVDPYGLPPPV
PGLPDTCGGHSHANMGSLI
Download sequence
Identical sequences A0A167WI51 B6GXT2
500485.B6GXT2 Pchr_Wisconsin_54-1255:Pc12g15550.t1 XP_002558355.1.37043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]