SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B6GZI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B6GZI2
Domain Number 1 Region: 12-63
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000199
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 2 Region: 84-120
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.000000611
Family Zn2/Cys6 DNA-binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B6GZI2
Sequence length 182
Comment (tr|B6GZI2|B6GZI2_PENRW) Pc12g09540 protein {ECO:0000313|EMBL:CAP80581.1} KW=Complete proteome; Reference proteome OX=500485 OS=Wisconsin 54-1255) (Penicillium chrysogenum). GN=Pc12g09540 OC=Penicillium chrysogenum species complex.
Sequence
MKRQVQKPETRTGPRMWKCKECSSSFQRLDHMKRHALTHHTVKSHLCLFCGSSFSRGDVL
RRHWKSCKARVEGGYEIPEPERGGKHKRACDSCASLRKACNGEMPCAECTQRAKQCAYQR
LLDDELPLPSTSQALPETRDVERASSSNDAPKVSESSWDLGPATLYPPHMKIIAGRQKFA
LG
Download sequence
Identical sequences B6GZI2
Pchr_Wisconsin_54-1255:Pc12g09540.t1 XP_002557781.1.37043 500485.B6GZI2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]