SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B6H3U1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B6H3U1
Domain Number 1 Region: 41-148,184-219
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000642
Family N-acetyl transferase, NAT 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B6H3U1
Sequence length 255
Comment (tr|B6H3U1|B6H3U1_PENRW) Pc13g07410 protein {ECO:0000313|EMBL:CAP91810.1} KW=Complete proteome; Reference proteome OX=500485 OS=Wisconsin 54-1255) (Penicillium chrysogenum). GN=Pc13g07410 OC=Penicillium chrysogenum species complex.
Sequence
MARTPISRMDERSGKQRSINPSYNRPLSHKAKEIQEATASEPLTLEEEYSMQRSWRQDAD
KLTFIVCRAITTGTEDEIPSQRKLQAESDSPATMVGDINLFLRIDDGEEGDSPPQIVGEV
ELMIAEKVNQRRGFGRAALLMFMRYIVQNQGAILDEFVSGGDVGVKTVRKLRTGVETTGS
SEGLALEYLSVKIGQTNLRSLALFEGLGFERVSAEPNFFGEFELRKTDLSLGGVDAALEG
AQVRGFIALPYERTE
Download sequence
Identical sequences A0A161ZKQ1 B6H3U1
Pchr_Wisconsin_54-1255:Pc13g07410.t1 500485.B6H3U1 XP_002559171.1.37043 jgi|Pench1|23412|fgenesh1_pg.2_#_767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]