SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B6HB89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B6HB89
Domain Number 1 Region: 26-196
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 8.81e-26
Family N-acetyl transferase, NAT 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B6HB89
Sequence length 215
Comment (tr|B6HB89|B6HB89_PENRW) Pc18g03210 protein {ECO:0000313|EMBL:CAP94545.1} KW=Complete proteome; Reference proteome OX=500485 OS=Wisconsin 54-1255) (Penicillium chrysogenum). GN=Pc18g03210 OC=Penicillium chrysogenum species complex.
Sequence
MASKEEFVTVKAFLPTVPLPANSERPAITTDRLLVRALQSTDLEALHVLRTQEEVMKWTS
AGCIDDSIEKTKSKLDPFLPPNDRVTANCAICLKETGELIGIGGCHLYPGRHGWPEVGYM
LRTEAWGKGIATEFLSAWLRFWSELPRTQREVRVQKEMVIGEGIVDEHLIAITEASNSGS
QRVLLKCGFERFREFVEVDDTKTVNLVAFRFLPKR
Download sequence
Identical sequences A0A161ZIG2 B6HB89
Pchr_Wisconsin_54-1255:Pc18g03210.t1 XP_002562161.1.37043 500485.B6HB89

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]