SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B6HFK4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B6HFK4
Domain Number 1 Region: 3-127,162-198
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000000131
Family N-acetyl transferase, NAT 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B6HFK4
Sequence length 227
Comment (tr|B6HFK4|B6HFK4_PENRW) Pc20g10030 protein {ECO:0000313|EMBL:CAP86332.1} KW=Complete proteome; Reference proteome OX=500485 OS=Wisconsin 54-1255) (Penicillium chrysogenum). GN=Pc20g10030 OC=Penicillium chrysogenum species complex.
Sequence
MITNRPATLADIPQVRDINHWYIVNSCSTFATTPPPISHYEDILRDLMRRNLPFYVIVSD
TRKTPDGADLILGYAYLSPFRGHLLSYAPTVELSIFMRYDQQQFGYGTIILRKLLRLVQE
GEVEHRCEERVGDIPRIGFGSSMGVMKTSLVQNIIAIIPYDTEAPTDGERLRKWYMKWGF
IEKGQLENVGRKMGHWIDTVYLQWTMPEQTDDESEYPYDKDEDRKYA
Download sequence
Identical sequences B6HFK4
500485.B6HFK4 Pchr_Wisconsin_54-1255:Pc20g10030.t1 XP_002563497.1.37043 jgi|Pench1|38066|fgenesh1_pm.6_#_70

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]