SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B6HNS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B6HNS1
Domain Number 1 Region: 1-162
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 5.66e-23
Family N-acetyl transferase, NAT 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B6HNS1
Sequence length 177
Comment (tr|B6HNS1|B6HNS1_PENRW) Pc21g13960 protein {ECO:0000313|EMBL:CAP96293.1} KW=Complete proteome; Reference proteome OX=500485 OS=Wisconsin 54-1255) (Penicillium chrysogenum). GN=Pc21g13960 OC=Penicillium chrysogenum species complex.
Sequence
MKIQIEPAQFPEDADSILSLFSDYATSLGIDLTFQSFQEELDSLPGKYAPSQGGALLIAR
VDTGVHEYDTDGLVDTIIPPQFPSALGCVALRRSSDGWCEMKRLYVLKEARGERLGEKLV
QAILAQARALGYRGMRLDTLPEMTAAQRLYRKYGFVDIAPYYDTPIQRTVFMGCELL
Download sequence
Identical sequences A0A167U8H1 B6HNS1
Pchr_Wisconsin_54-1255:Pc21g13960.t1 jgi|Pench1|66037|e_gw1.1.2402.1 500485.B6HNS1 XP_002568413.1.37043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]