SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B6I9S1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B6I9S1
Domain Number 1 Region: 443-548
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000863
Family Anti-sigma factor antagonist SpoIIaa 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B6I9S1
Sequence length 550
Comment (tr|B6I9S1|B6I9S1_ECOSE) Putative sulphate transport protein {ECO:0000313|EMBL:BAG76780.1} KW=Complete proteome OX=409438 OS=Escherichia coli (strain SE11). GN=ECSE_1256 OC=Enterobacteriaceae; Escherichia.
Sequence
MPFRALIDACWKEKYTAARFTRDLIAGITVGIIAIPLAMALAIGSGVAPQYGLYTAAVAG
IVIALTGGSRFSVSGPTAAFVVILYPVSQQFGLAGLLVATLLSGIFLILMGLARFGRLIE
YIPVSVTLGFTSGIGITIGTMQIKDFLGLQMAHVPEHYLQKVGALFMALPTINVGDAAIG
IVTLGILVFWPRLGIRLPGHLPALLAGCAVMGIVNLLGGHVATIGSQFHYVLADGSQGNG
IPQLLPQLVLPWDLPNSEFTLTWDSIRTLLPAAFSMAMLGAIESLLCAVVLDGMTGTKHK
ANSELVGQGLGNIIAPFFGGITATAAIARSAANVRAGATSPISAVIHSILVILALLVLAP
LLSWLPLSAMAALLLMVAWNMSEAHKVVDLLRHAPKDDIIVMLLCMSLTVLFDMVIAISV
GIVLASLLFMRRIARMTRLAPVAVDVPDDVLVLRVIGPLFFAAAEGLFTDLESRLEGKRI
VILKWDAVPVLDAGGLDAFQRFVKRLPEGCELRVCNVEFQPLRTMARAGIQPIPGRLAFF
PNRRAAMADL
Download sequence
Identical sequences A0A1J8LSS2 B6I9S1 E9TIY1
gi|209918447|ref|YP_002292531.1| 409438.ECSE_1256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]