SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B6R1M8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B6R1M8
Domain Number 1 Region: 75-209
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 5.75e-23
Family GntR ligand-binding domain-like 0.0063
Further Details:      
 
Domain Number 2 Region: 4-73
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000204
Family GntR-like transcriptional regulators 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B6R1M8
Sequence length 223
Comment (tr|B6R1M8|B6R1M8_9RHOB) Transcriptional regulator, GntR family {ECO:0000313|EMBL:EEA95246.1} KW=Complete proteome OX=439495 OS=Pseudovibrio sp. JE062. GN=PJE062_2815 OC=Rhodobacteraceae; Pseudovibrio.
Sequence
MPSSTSNVSIAYRKLKQAILENRLGPGTQVLEQEAATQLEMSRTPVREAMLMLQKDGLVE
MRPRQGMRVLPITVGDISEIYEILEVVEGLAIRKLAEKPINEKEARALEDSVTLMDLSLE
RGDLSVWAAADKKFHEDIVKFSGNVHLETVFLQLWDRSQRARNMLLKAHGAPVNSAQEHW
ELLKFIKEGKAAEAVEFQKSLRAEAAEQICKMIFDVMGGMVPS
Download sequence
Identical sequences A0A1I7B973 B6R1M8 G8PPN1
WP_008548542.1.27339 WP_008548542.1.37095 WP_008548542.1.37980 WP_008548542.1.38711 gi|374329160|ref|YP_005079344.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]