SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B6YUN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B6YUN6
Domain Number 1 Region: 2-168
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 9.02e-43
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B6YUN6
Sequence length 170
Comment (tr|B6YUN6|B6YUN6_THEON) 2-oxoacid:ferredoxin oxidoreductase, gamma subunit {ECO:0000313|EMBL:ACJ16072.1} KW=Complete proteome; Reference proteome OX=523850 OS=Thermococcus onnurineus (strain NA1). GN=TON_0585 OC=Thermococcus.
Sequence
MQIRFAGIGGQGVVLAGVILGEAAAIEGLNVLQTQDYSSASRGGHSIADVIISKEPIYDV
IVTKADVLVALHRLGYDTVKEELKEDGILIIDTDLVKPDKDYIGAPFTRLAEENTGLALT
VNMVALGYLVAKTGVVKKENVEEAIKRRVPKGTEEINIKAFNAGYEEGLK
Download sequence
Identical sequences B6YUN6
gi|212223733|ref|YP_002306969.1| 523850.TON_0585 WP_012571544.1.24713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]