SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B7FWV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B7FWV2
Domain Number - Region: 490-505
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0398
Family Retrovirus zinc finger-like domains 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B7FWV2
Sequence length 648
Comment (tr|B7FWV2|B7FWV2_PHATC) Predicted protein {ECO:0000313|EMBL:EEC49268.1} KW=Complete proteome; Reference proteome OX=556484 OS=Phaeodactylum tricornutum (strain CCAP 1055/1). GN=PHATRDRAFT_45213 OC=Bacillariophycidae; Naviculales; Phaeodactylaceae; Phaeodactylum.
Sequence
MMTLTPSNLSSFPGGNQTMETTTKSSAARPSMFRKSLSVRSLSSQSNALVKQKGAFTVQR
SKRIEPSSEVNRIGISEQGFSCQRETEKRPVTRPPDYEGSLVGNKTTTSRRSFLRMNMYA
HSQSATNLIPKEKSFQRSSSCRSVVSKQTKSSDCVMKAKLRSTRGTYGTGEQQNSIGKQS
KGDVRNAFKTMLDRPSHLQGDSGLPKSTALAMPAILIETSDVGEEGTDLGDSFFQCVGNE
GSTKDCMERESRYSTVAPVTAFSDHNKPIPETKMRKMLKKALSINWTRNLAPKQQGPAED
EKNTEAAHANPNSESRKKCPPQTSTSRRPHLRKSSSIRARKEKSFAAIILGNEELSTKPS
QLFPSKPRSLTQRRQHQNQSDARRQVSVNSGYDSFKKLPSTPHLTSFRESDLTLPVSDRM
GSKLSESGKTKPSREPSTDDLLQITPAGEARTALMRRPKGKRFFQLNQMPNESDLCTTSR
TGGVHVNIEVICQLCDQEGHSAKHCFLLHPFKAKPMGPATVSDLHVEAENATPEILRFAA
EDAVKNQQSADTKTSRGRTKRKTRHLGQPLPGYDSPPQMSVELGILQQGLKKESSERPDS
EKLSLGKDIVYQPVHESDTTVFLTPPLRRPTGEHLSEMYEWQQAFLPR
Download sequence
Identical sequences B7FWV2
2850.JGI45213 jgi|Phatr2|45213|estExt_fgenesh1_pg.C_chr_60219 XP_002179445.1.39622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]