SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B7HEL5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7HEL5
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.57e-29
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B7HEL5
Sequence length 83
Comment (tr|B7HEL5|B7HEL5_BACC4) PTS system, cellobiose-specific IIA component {ECO:0000313|EMBL:ACK64003.1} KW=Complete proteome OX=405532 OS=Bacillus cereus (strain B4264). GN=BCB4264_A5334 OC=Bacillus cereus group.
Sequence
MEAIDCAKRGEFTEAEAKLQEALEELKEAHRVQTELIQKEAGGEKTEVTLLMVHAQDHLM
NAITVKELASEFVELYRKMSVDE
Download sequence
Identical sequences A0A162TA00 B7HEL5 C2N954 C2RFX3 C2T8M0 C2ULK1 C2XJB3 M1QNR6 N1LH19
gi|452201703|ref|YP_007481784.1| gi|218236054|ref|YP_002369989.1| 405532.BCB4264_A5334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]