SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B7J653 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7J653
Domain Number 1 Region: 9-318
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 4.73e-109
Family Adenylation domain of NAD+-dependent DNA ligase 0.000000441
Further Details:      
 
Domain Number 2 Region: 405-585
Classification Level Classification E-value
Superfamily RuvA domain 2-like 1.48e-58
Family NAD+-dependent DNA ligase, domain 3 0.0000164
Further Details:      
 
Domain Number 3 Region: 321-402
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.37e-27
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00061
Further Details:      
 
Domain Number 4 Region: 590-669
Classification Level Classification E-value
Superfamily BRCT domain 2.94e-18
Family DNA ligase 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B7J653
Sequence length 671
Comment (sp|B7J653|DNLJ_ACIF2) Polydeoxyribonucleotide synthase [NAD(+)] {ECO:0000255|HAMAP-Rule:MF_01588} KW=Complete proteome; Reference proteome OX=243159 OS=104768 / NCIMB 8455) (Ferrobacillus ferrooxidans (strain ATCC 23270)). GN=AFE_0757; OC=Acidithiobacillaceae; Acidithiobacillus.
Sequence
MERVNHTDFERIQQLRAELVAANNAYYREDSPTLSDAEYDARLRELRTLEDRNPQWQSAD
SPTQRVGAAPVEVFGEVHYAIPLTSLDNVFDQDGFSDWLARVQKGLGREDVPLSAEPKFD
GLSVNIRYIEGKLVQAGTRGDGQTGEDVTANVRTIRNVPLQLTGKDWPELLEVRGEVVIP
VAAFRRLNGERLRAGDNPFANPRNAAAGSLRQLDSSVTAKRPLAYFPWGWGESSVPLGKS
HIAVMERLSAWGFEVTSYLRGVHELTECQRYFSEMQKIREGMPFEIDGLVFKVDDLLARE
QLGFTARAPRWAIAYKFPAHEERTVVEDILASVGRTGVITPVAVLKPVQVGGVTVSRASL
HNQDEVDRKDIRVGDTVLVRRAGDVIPEVVMVIKEERPPATQPWHMPQRCPVCGSEVLRL
ANESAHRCMGGLYCPAQRMGAIRHFASRRAMDIRGLGEKLVEQLVGHGLVHTVADIYHLD
EAALCGLERMASRSAQKLLAEIDRSRHTSLPRFLYALGIRQVGEGTAKSLAIYFGDLDPL
MAATPELLQNIPDVGPIVAESVAHFFAQPHNRDVIAALRAAGVQWAVVQPQKGGRFQGMT
LVLTGALDNMTREEAKTAIENAGGKVSGSVSAKTSYVVVGKDPGSKAEKAAKLGVKQLTE
AQFLAMFSEKE
Download sequence
Identical sequences B5EP61 B7J653
WP_012536336.1.13253 WP_012536336.1.28209 WP_012536336.1.49158 WP_012536336.1.50737 WP_012536336.1.90948 243159.AFE_0757 380394.Lferr_0903 gi|198283038|ref|YP_002219359.1| gi|218666742|ref|YP_002425245.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]