SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B7J7S5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7J7S5
Domain Number 1 Region: 216-397
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.05e-54
Family B3/B4 domain of PheRS, PheT 0.0000627
Further Details:      
 
Domain Number 2 Region: 478-692
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.46e-47
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000745
Further Details:      
 
Domain Number 3 Region: 35-191
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.94e-42
Family Myf domain 0.0021
Further Details:      
 
Domain Number 4 Region: 701-798
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.57e-23
Family Anticodon-binding domain of PheRS 0.00078
Further Details:      
 
Domain Number 5 Region: 414-486
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 7.6e-17
Family Domains B1 and B5 of PheRS-beta, PheT 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B7J7S5
Sequence length 799
Comment (tr|B7J7S5|B7J7S5_ACIF2) Phenylalanyl-tRNA synthetase beta subunit {ECO:0000256|HAMAP-Rule:MF_00283} KW=Complete proteome; Reference proteome OX=243159 OS=104768 / NCIMB 8455) (Ferrobacillus ferrooxidans (strain ATCC 23270)). GN=AFE_2609 OC=Acidithiobacillaceae; Acidithiobacillus.
Sequence
MRVSVQWLRELLQISWDTEETARRLTMGGIEVEAIEDAAPSFRGVVVAAVRSVAPHPQAD
KLRVAEVDAGDGRLRTIVCGADNLAAGQRVPLALPGALLPGEHCIATSVLRGVSSEGMLC
AAAELGIDDGSSGLLVLDADAPVGADLRAYLGLDDQILTLGITPNRGDALSVAGVARDLF
ALGAEALSLPTAAIPEPAWAIVRPGEVVPGNGGFAPHIAADAQNACRSYTVLWIEGVPER
LPDYLRERLRRAGQRCIHPVVDLLNLQMLETGQPLHAFDAEALQGNLTVRWAQIGETLDA
LDGRDLPLESDMLVIADDAGPVALAGIIGGRRTAVTAQTRSIVLESAFFQPGAIQGRARR
LGLQTDAAMRFERGVDFTLGPVMATRTLQLFVTLGTARLRTERSCTVLGQLPEHRPIPLR
RARLARILGMDYEDDVVETALTRLGLHVNRVPDGWQAIPPSHRFDLRIEVDLIEEVGRIY
GYERLPAHRPEGILQPLPMTRGPQAATLRSVLQARDYHEVITYSFISRQAQHLFTPDADA
PALLNPLSADLAVMRASLWPGLMQVLQFNMKRQQERVRIFELGRVFSANGQRLVLGGCIV
GTADRESWAEPLRAVDFYDLKGDVSALLALWPGTDFSFRPLDAYPALHPGQAAEICVEDR
RVGVLGALHPTLVAEYDLDKSPFFFYLDVEWLGNLTSISRFSSLSPFPALRRDIALVIPN
DILAGTVLDTMRAAASGIVRSITIFDRYQGSSLVAGTYSLAFALLLQDVGRTLTDTEVQA
EMDRLLVAVRQLGSIELRA
Download sequence
Identical sequences B5EN52 B7J7S5
gi|198284327|ref|YP_002220648.1| WP_012537289.1.49158 WP_012537289.1.50737 243159.AFE_2609 380394.Lferr_2238 gi|218667218|ref|YP_002426988.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]