SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B7JZV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7JZV2
Domain Number 1 Region: 14-411
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 8.24e-139
Family ArgJ-like 0.000000745
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B7JZV2
Sequence length 414
Comment (tr|B7JZV2|B7JZV2_CYAP8) Arginine biosynthesis bifunctional protein ArgJ beta chain {ECO:0000256|HAMAP-Rule:MF_01106} KW=Complete proteome; Reference proteome OX=41431 OS=RF-1)). GN=PCC8801_0969 OC=Cyanothecaceae; Cyanothece.
Sequence
MTDWQEISGGITAPKGFKATGMAAGLKPSGNPDLALIVSETDAIAAGVFTTSQVRAACVD
YCRQRLQQKSSIRAILCNAGQANAATGEQGWQDALDSAQSIAQALNISHEEILLASTGVI
GQRIKMEALQKAIPQLVSNLSETGGDSAANAIMTTDLVPKSIALETIIDGRPVRIGGMAK
GSGMIHPNMATMLAFVTCDGLVTTHLWQQMLTEAANQSFNQITVDGDTSTNDTLIALANG
QSRTPTITEITSKDGQKLQAMLTAVCQYLAKAIARDGEGATCLVEVQVSGASDNEGARRI
AKTIAGSSLVKSAIFGRDPNWGRIAAAAGRAGVSFNQEELQIKLGHFLMMENGQPLTFDR
DAASNYLKQAAAGAYLKEDTVLISLCVGNGSGHGIAWGCDLSYDYVKINAEYTT
Download sequence
Identical sequences B7JZV2
gi|257058878|ref|YP_003136766.1| 395962.Cyan8802_0998 41431.PCC8801_0969 WP_012594320.1.62203 WP_012594320.1.93053 gi|218245830|ref|YP_002371201.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]