SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B7KUN3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7KUN3
Domain Number 1 Region: 5-337
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.06e-96
Family AAT-like 0.000000506
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B7KUN3
Sequence length 346
Comment (tr|B7KUN3|B7KUN3_METC4) L-threonine aldolase {ECO:0000256|PIRNR:PIRNR038940} KW=Complete proteome OX=440085 OS=(Methylobacterium chloromethanicum). GN=Mchl_3442 OC=Methylobacteriaceae; Methylobacterium.
Sequence
MAEQQFASDNYAGICPEALTAMQAANAGHAPAYGADTWTQAAADGFRRLFETDCEVFFVF
NGTAANSLALASLCQSYHSVICADSAHIETDECGAPEFFSNGSKLLTAATDDGKLTPEIV
RTIAGKRSDIHFPKPRAVTLTQATETGRVYSLDEIAAISAVCRALGLRLHMDGARFANAC
ASLDASPAELTWKAGVDVLCFGGTKNGMAVGEAVIFFDRKLAEDFDYRCKQAGQLASKMR
YLSAPWVGMLENGAWLDNARHANECARRLVRGIADVPGISLAAPVEANGVFLNLPAPVQE
GLRARGWQFYGFIGGASRFMFAWDSEPARVDALAQDIRLCALPAAA
Download sequence
Identical sequences B7KUN3
WP_015951561.1.65134 440085.Mchl_3442 gi|218531374|ref|YP_002422190.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]