SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7U2G7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7U2G7
Domain Number 1 Region: 3-136
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-42
Family Galectin (animal S-lectin) 0.00000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B7U2G7
Sequence length 138
Comment (tr|B7U2G7|B7U2G7_PIG) Galectin {ECO:0000256|RuleBase:RU102079} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=LGALS7 OC=Sus.
Sequence
MSGFSMPHKTLLADGIRVGTVMRIRGVVPDQAGRFYVNLLCGEEPGSEAALHFNPRLDES
SVVFNSLEHGAWGREERGPGIPFQRGQPFDVLLITTDEGFKVVVGDLEYHHFRHRMPPTR
VRAVEVGGDLQLELVKIF
Download sequence
Identical sequences B7U2G7
ENSSSCP00000026387 ENSSSCP00000026387 NP_001136315.1.46622 XP_020948908.1.46622 XP_020948909.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]