SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B8AW90 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8AW90
Domain Number 1 Region: 220-606
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.88e-95
Family Regulator of chromosome condensation RCC1 0.00056
Further Details:      
 
Domain Number 2 Region: 13-118
Classification Level Classification E-value
Superfamily PH domain-like 1.64e-25
Family Pleckstrin-homology domain (PH domain) 0.0037
Further Details:      
 
Domain Number 3 Region: 605-672
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.3e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B8AW90
Sequence length 1038
Comment (tr|B8AW90|B8AW90_ORYSI) Uncharacterized protein {ECO:0000313|EMBL:EEC79635.1} KW=Complete proteome; Reference proteome OX=39946 OS=Oryza sativa subsp. indica (Rice). GN=OsI_20852 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MASDACSGLHLALITLKKGSKLIKYSRKGKPKIREFRLSSDENTLVWYSHNKEKCLRLSS
VSKVIPGQRTAVFRRFLRPEKDYLSFSLIYKNGQRSLDLVCKDQAEVEVWFSTLESLITS
CRLNFLNDGQTDRVSFSEDVTIYQDSTSYDTTLDIASSITRSFNSAGYSTPNSLNSIRAD
VGSDRVNMLRASTGDNSRVSISSAPSSSSQSSGLDDIESLGDVYVWGEVWTEVLPSEGSS
NYLCSKTDFLIPKPLESDVVLDVQQIACGSRHIGLTTRQGEVFTWGEELGGRLGHGTDTD
ICRPKLVESLAVSNVEYIACGEFHTCVVTASGDLYDWGDGSYNAGLLGHGTGVSHWLPKR
VSGPLEGLQVLSVACGSWHSALTMSSGKLFTFGDGTFGSLGHGDRESVAYPKEVEALSGF
RAMKVACGVWHSAAIVEISGQASTNAMSRKLFTWGDGDKNRLGHGDKEAKLVPTCVQALV
DHNFHQVACGHSMTVALATSGHVFTMGSSNNGQLGNPKADGKQPCMVQDKLGNELVEEIS
CGSNHVAALTSRSEVYTWGMGANGRLGHGSVEDKKKPTLVDALKDRHVKSISCGSNFTTC
ICIHKWVSGADQSVCSGCRQPFGFTRKRHNCYNCGLVHCHACSSRKVLKAALAPTPGKPH
RVCDSCFMKLKAADTGVISSYNKRNVITRRSIDIKDKLERPEIRPSRLATTSPAEPVKYQ
ETKNVRNETKPADPMSMMKASQVPAMLQFKDMAFAGTFGTVPTTVKSMTMGGQMQMGMPM
FSPSPPSKKPSPPPATASPLIGKVDNDGLKKTNELLNQDISKLQSQVNKLKQKCETQDEQ
LQKAERKAKQAASMASEESARRNTVLDFVKHLDSELKVIADRVPGDVADNLKTLQSQSER
FLAGQSSNLVEITGLTGHDIGHHRSSSTGSLPVSQDGSSGNASGSSIAMASDSPCHRIME
NNLKAPGDFAPKYGTHGEVQLIEQFEPGVYVTLIQLRDGTKVFKRVRFSKRRFAEQQAEE
WWRENQERVFKKYNHPTN
Download sequence
Identical sequences B8AW90
OsIBCD018777 39946.BGIOSIBCE019888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]