SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B8CLZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8CLZ6
Domain Number 1 Region: 1-107
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.49e-21
Family Anti-sigma factor antagonist SpoIIaa 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B8CLZ6
Sequence length 110
Comment (tr|B8CLZ6|B8CLZ6_SHEPW) Anti-sigma factor antagonist {ECO:0000256|RuleBase:RU003749} KW=Complete proteome OX=225849 OS=Shewanella piezotolerans (strain WP3 / JCM 13877). GN=swp_2169 OC=Shewanellaceae; Shewanella.
Sequence
MQFDIIEKGQYTIVQINEGRFDAKLAPAFREQLEQIKGNIREHLVLDLGEVRFMDSSGLG
AVMGAYKMLRNTKISIVNPQKPVTDLLKLTRMDKLILSHPTIEDALAPTA
Download sequence
Identical sequences B8CLZ6
225849.swp_2169 gi|212634982|ref|YP_002311507.1| WP_020912282.1.101980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]