SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B8CYA7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8CYA7
Domain Number 1 Region: 1-106
Classification Level Classification E-value
Superfamily YheA/YmcA-like 1.14e-29
Family YheA-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B8CYA7
Sequence length 111
Comment (tr|B8CYA7|B8CYA7_HALOH) Uncharacterized conserved protein {ECO:0000313|EMBL:ACL70276.1} KW=Complete proteome; Reference proteome OX=373903 OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562). GN=Hore_15270 OC=Halothermothrix.
Sequence
MSIIKKAEELGKEIVDSAEYKELKSTEEAMQNDKEAQSLLNEFRSKQQRLQMAQANGKNI
TEDQKKELMALQARMQENEKIKNFMTAQQKFNQVMQTVNQAITGIIAGQHA
Download sequence
Identical sequences B8CYA7
WP_012636459.1.20074 373903.Hore_15270 gi|220932363|ref|YP_002509271.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]