SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B8D3M2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8D3M2
Domain Number 1 Region: 6-135
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 5.23e-26
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.0024
Further Details:      
 
Domain Number 2 Region: 145-251
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 1.96e-16
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B8D3M2
Sequence length 258
Comment (tr|B8D3M2|B8D3M2_DESA1) Aldehyde oxidase and xanthine dehydrogenase family protein, middle subunit {ECO:0000313|EMBL:ACL10703.1} KW=Complete proteome; Reference proteome OX=490899 OS=B-2413 / 1221n) (Desulfurococcus kamchatkensis). GN=DKAM_0377 OC=Desulfurococcaceae; Desulfurococcus.
Sequence
MIRDRKIPVPKYLVDLSPLRRDLSYVVVENGVVRIGALTTLWELSKSILHQDIKYAGFID
VFRKFGTMAIRFNATIGGNIASATQYSDYITLLLVYDAELRLESVHGVRKVRLEEFLVDK
RKTILMPNEIITEISFKEPPSKTSSAFIKFDRRELLIAGIVTGAVYLTEEEGRIREARIA
FDMISEHRIPGRARSTEKCITGRNISEETLIEAEQCLDKEMKRISDWWATSEYRLEMSKA
ILRKGLRLVHNRILNGVM
Download sequence
Identical sequences B8D3M2
gi|218883688|ref|YP_002428070.1| 490899.DKAM_0377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]