SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B8E9E9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8E9E9
Domain Number 1 Region: 446-537
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000216
Family Anti-sigma factor antagonist SpoIIaa 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B8E9E9
Sequence length 585
Comment (tr|B8E9E9|B8E9E9_SHEB2) Sulphate transporter {ECO:0000313|EMBL:ACK46482.1} KW=Complete proteome OX=407976 OS=Shewanella baltica (strain OS223). GN=Sbal223_1978 OC=Shewanellaceae; Shewanella.
Sequence
MKFPSLISFMPGLAQLLQYEKQWLRDDVRAGLSVAAVALPVAIAYAQLTGVNAAVGLYSC
VLPMLVYALFGTSKQLIVGPDAATCAVIAAVVTPLAAGDSMKHWQLVMTMTAMTGFWCLI
ASRFKLGVLADFLSKPILMGLLNGVAITIIVGQFSKIFGFTFDERYLIERLSGAPSYLSK
THWPTLTMGIVTLATYALVKRFRPQWPASMCAMAMAAFLVWVFNLTSFDISVVGEVTSGL
PSFQAPAFDLGIARELVVPALNLAMVSFVSMMLTARSFAAKNGYDIDADKEFRALGLANI
ASAISQGFAVSGADSRTAVNDANGGKSQLVSIIAAVLIGVVALFFTAPLKYIPSAALGVV
LVIASISLIDLKSLWNLRVRDKSAFLLACITLFSVLFIGVIPGITLAVLLGLFQFLATVM
RPTDQVLGLDHKGVIRSVDDSGKAKSVPGVFMYRFNSPLTYFNATYFKRRLLEKFIRESE
PVDCIIIDAVPCFTHLDLSVMAMLADLHQLLKKRGVRLVLAGRKRQMLSWFEQAGMQTGE
GGILIRPDLYLALKMNQSYKQALAEGQAPVIQKVPDDAVLLHSHL
Download sequence
Identical sequences A0A165JUB2 A3D561 A9L3P2 B8E9E9
gi|126174594|ref|YP_001050743.1| gi|160875596|ref|YP_001554912.1| gi|378708796|ref|YP_005273690.1| WP_011846940.1.19221 WP_011846940.1.24904 WP_011846940.1.35668 WP_011846940.1.35710 WP_011846940.1.60405 WP_011846940.1.74325 WP_011846940.1.8014 WP_011846940.1.85636 WP_011846940.1.86146 WP_011846940.1.93117 gi|217973154|ref|YP_002357905.1| gi|153000889|ref|YP_001366570.1| 325240.Sbal_2381 399599.Sbal195_2484 402882.Shew185_2369 407976.Sbal223_1978 gi|386341349|ref|YP_006037715.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]