SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B8FN93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8FN93
Domain Number 1 Region: 130-405
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 1.05e-24
Family Tricorn protease N-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 46-179
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.000000000981
Family DPP6 N-terminal domain-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B8FN93
Sequence length 610
Comment (tr|B8FN93|B8FN93_DESAA) Periplasmic component of the Tol biopolymer transport system-like protein {ECO:0000313|EMBL:ACL06062.1} KW=Complete proteome; Reference proteome OX=439235 OS=Desulfatibacillum alkenivorans (strain AK-01). GN=Dalk_4383 OC=Desulfobacteraceae; Desulfatibacillum.
Sequence
MKRGFKCALVRALILLLILGPISGWAADSSEDWGLDGAVTDTEGLVVNILELSTEYDSAY
PGWGNWNWSSDGAKIVYQVDDSNLSNSSEICVINADGTGFTRLTDNDRCDSHASFVWPNN
AKVVFQRNVASSGNGEIWIVNVDGSNPTSLTQAHNGPMGGASAGENNPMVSPDGTKVAFR
GCVPASDGYAHLFVMDIDGANVKDVAAYNDRIIDISHHCWSPDSKWVCFKACDESVGDAR
IFKVKADGTAAPVKLSPADDAMPAAWNDWFCQNWPRWSPDGKWISTSLYTGENYNDKKIV
IMDSDGQNMKTIMAQDGDDDGDNYDWIHQSGTWSPDSKWLVYSMNTVAEGDTALCISNVD
NGAFYQLTKDYEDCQPRWSPSPKNKPGSILFKGHSGGDGLFLLNLAPWALDEISASGRSD
FASCGSTSWSQAGICLDVDLGAGGEEPIFIGALYDGNPTPQNFDGTFWDLYCPDPTNVVS
VTLGLYFNGYYPGMGFYWFDEDANNWDELDPLMCEVTEGLYLRSGITYTAVISMTLTSVT
TPSLEQLTGTVFAAGSIPEDDDIFDWAGKDDLDCFVKSVDGGKTSAAPYALLFLGLAMGF
AFFNRPASRK
Download sequence
Identical sequences B8FN93
gi|218782212|ref|YP_002433530.1| 439235.Dalk_4383 WP_015949108.1.12191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]