SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B8G534 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8G534
Domain Number 1 Region: 438-543
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.53e-20
Family Anti-sigma factor antagonist SpoIIaa 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B8G534
Sequence length 594
Comment (tr|B8G534|B8G534_CHLAD) Sulphate transporter {ECO:0000313|EMBL:ACL23667.1} KW=Complete proteome OX=326427 OS=Chloroflexus aggregans (strain MD-66 / DSM 9485). GN=Cagg_0743 OC=Chloroflexaceae; Chloroflexus.
Sequence
MHNLLGRLPILSTWQREFAGYSPTHLRSDILAGLTTGAVALPLALAFGVASGADAPAGLI
TAILAGLIIGGLGGAAYQISGPTGAMSAILIAISARYGIEGVWVATLLAGLIMIGLGLAR
LGRYIAFIPSPVIAGFTGGIALIIAIGQLDNVLGIQTPKAENALEKLLHYFTHPLIPDRH
TLVIAGIVIAIMIVLPRFHKGIPASLVGIIVATAISVGLGWNVPIIGDIPQTILLDHRLT
WQTIPWDHLGDLLTPAVSIAALGAIESLLCGAVGSTMSGKPFDSNQELVAQGIGNLLIPF
FGGVPATAAIARTSVAIKSGAVTRLTSIVHALLLLLSALALGPILRYVPLAALGGVLLMT
AWRMNEWESIHFFVNARLRHALIGFFITMLATAALDLTQAILIGIAISAVIYLRQSATST
VVTSSPINPQQLQGQGSPITATCPSIHVYYLTGPLFFGSVTTVLEAFETAGDYHTIIISM
RGVPLIDAMGIQALHQIVEEHHARGGEVIFTALQPNVLEMFKRTGLFDLVGARNIYWSSA
HAIVELHEKRLVAGCPRCHAHGDSCQVLQMARERLGNQPTPLSLPTASSSTHTS
Download sequence
Identical sequences B8G534
WP_012616033.1.86148 gi|219847670|ref|YP_002462103.1| 326427.Cagg_0743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]