SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B8GKD0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8GKD0
Domain Number 1 Region: 105-284
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 5.35e-58
Family Formate/glycerate dehydrogenases, NAD-domain 0.00000772
Further Details:      
 
Domain Number 2 Region: 7-138
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 2.46e-36
Family Formate/glycerate dehydrogenases, substrate-binding domain 0.00014
Further Details:      
 
Domain Number 3 Region: 322-454
Classification Level Classification E-value
Superfamily Serine metabolism enzymes domain 3.14e-32
Family SerA intervening domain-like 0.0021
Further Details:      
 
Domain Number 4 Region: 449-528
Classification Level Classification E-value
Superfamily ACT-like 5e-16
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B8GKD0
Sequence length 532
Comment (tr|B8GKD0|B8GKD0_METPE) D-3-phosphoglycerate dehydrogenase {ECO:0000256|RuleBase:RU363003} KW=Complete proteome; Reference proteome OX=521011 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c). GN=Mpal_0439 OC=Methanoregulaceae; Methanosphaerula.
Sequence
MGIIVNYRVLVSDPLAEEGLTILRDQVEVDVKTGLTEDQLIAIIDQYDALLVRSGTQVTA
KVIEAGTHLKFIGRAGVGVDNIDTDAATRQGIIVANAPEGNTLAATEHTVAMMMALARNI
PQANASVKRHEWKRSKFTGIEVNEKVLGVVGFGRIGKEVAKRAIAMNMRIVAYDPFISKE
KAAEIGVEIMTMAELFTVADFITVHTPLMKETTHIINDASIATMKDGVRIINCARGGIID
EQALYRGLVSGKIGGAALDVYEHEPPTDSPLIELDQVIMTPHLGASTVEAQINVAISVAK
QCLSVLSGGSARSAVNAPMIPADQLEFVEPFAVLAEKMGRLLLQLVEGRLEAIELVYGGE
FVERNSNTRFITRMALKGILDRLLHLPVNIVNAEFVAHERGIVVSQTVTRESQGFKNLIT
IKVRTDLGEETISGSVFSKVRSRIVAIGGYTMDLDPTGFLVISRHLDKPGVIGRASTILG
HCEVNIAGMQVGRIRPGEEAIMVLNVDSEVSDEAMDEIRSMPGIFSAKFAQI
Download sequence
Identical sequences B8GKD0
gi|219851104|ref|YP_002465536.1| WP_012617132.1.75456 521011.Mpal_0439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]