SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B8HEL4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8HEL4
Domain Number 1 Region: 1-391
Classification Level Classification E-value
Superfamily Phase 1 flagellin 2.35e-93
Family Phase 1 flagellin 0.00000646
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B8HEL4
Sequence length 391
Comment (tr|B8HEL4|B8HEL4_PSECP) Flagellin {ECO:0000256|RuleBase:RU362073} KW=Complete proteome OX=452863 OS=chlorophenolicus). GN=Achl_2998 OC=Pseudarthrobacter.
Sequence
MGMQINTNLAANNAYRSLSNTQNDLSKSLEKLSSGLRINRAGDDAAGLAISESLKSQIGG
LNVASRNAQDGIGLVQTAEGGLSQAHSILQRLRDLGVQAANDTNNTDSRAAIKTEATSLV
EELGRIAGSTDFNGTKLLNGDNASLKIQVGANGDAASQIGVDLSGANVKAIANTLNLGAL
ASGGSKFDIADATALAGAATFSSTKDGVVTTVTTADLGAAGSFTSVEGYADALRKDADFS
SKFTVSVEKDANGAGTGIVVQAKDGGDLLDADNATAGTGLAAGAATASVATGLDFSNASK
AQASITLIDTQIKNVSTARADLGATQNRLESAVQTINVAKENLTASNSRIRDTDMAEEMV
KFTRNNILSQAGTAMLAQANQSSQGVLQLLR
Download sequence
Identical sequences B8HEL4
452863.Achl_2998 WP_015938155.1.59127 WP_015938155.1.81542 gi|220913739|ref|YP_002489048.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]