SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B8HU97 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8HU97
Domain Number 1 Region: 3-99
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.34e-22
Family Anti-sigma factor antagonist SpoIIaa 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B8HU97
Sequence length 111
Comment (tr|B8HU97|B8HU97_CYAP4) Anti-sigma factor antagonist {ECO:0000256|RuleBase:RU003749} KW=Complete proteome; Reference proteome OX=395961 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141). GN=Cyan7425_2079 OC=Cyanothecaceae; Cyanothece.
Sequence
MNPSVKILQPTGLFGGTYVTTFRQQIEELVAAGTVIVLVDCQNISFMDSSGLGALVVALK
MLRAADGELFLCSLSKQIKMLFEMASMDQVFRVLADQREFEQTVVSRLPVD
Download sequence
Identical sequences B8HU97
WP_012627521.1.77409 395961.Cyan7425_2079 gi|220907492|ref|YP_002482803.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]