SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B8HV42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8HV42
Domain Number 1 Region: 1-109
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.35e-24
Family Anti-sigma factor antagonist SpoIIaa 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B8HV42
Sequence length 110
Comment (tr|B8HV42|B8HV42_CYAP4) Anti-sigma factor antagonist {ECO:0000256|RuleBase:RU003749} KW=Complete proteome; Reference proteome OX=395961 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141). GN=Cyan7425_0702 OC=Cyanothecaceae; Cyanothece.
Sequence
MKISTRQSDDVLIVDMEGRLDSRTAVDSNDEMERILKAGSKHIIVNLEKLDFLTSAGIRV
LLLTAKLQQSTGGQLRLCSANELVTETLETAGFSRLLRLYPTEAEAIKSF
Download sequence
Identical sequences B8HV42
WP_012626187.1.77409 395961.Cyan7425_0702 gi|220906139|ref|YP_002481450.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]