SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B8I4C7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8I4C7
Domain Number 1 Region: 5-137
Classification Level Classification E-value
Superfamily FlgN-like 3.4e-17
Family FlgN-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B8I4C7
Sequence length 166
Comment (tr|B8I4C7|B8I4C7_CLOCE) FlgN family protein {ECO:0000313|EMBL:ACL74481.1} KW=Complete proteome; Reference proteome OX=394503 OS=H10). GN=Ccel_0093 OC=Ruminiclostridium.
Sequence
MDTGLIKELTDILNKENDIYETFLKLSNSKTDLITNGNVSELESIVKIEQSLIIKIAKLE
DQREKIVESLSSVLGRKPEEVTISELSSCLGEKEAMELKACQEKILKSINGLKSNNELNS
KLIKNSLEYIDFSINMMTTVGTVTNSYGSSGNADEGKKRNLFDVKL
Download sequence
Identical sequences B8I4C7
394503.Ccel_0093 WP_012634547.1.84728 gi|220927552|ref|YP_002504461.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]