SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B8NKQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8NKQ4
Domain Number 1 Region: 92-139
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000742
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 2 Region: 134-176
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.00000565
Family Zn2/Cys6 DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B8NKQ4
Sequence length 634
Comment (tr|B8NKQ4|B8NKQ4_ASPFN) Zinc finger protein, putative {ECO:0000313|EMBL:EED49227.1} KW=Complete proteome; Reference proteome OX=332952 OS=12722 / SRRC 167). GN=AFLA_093080 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MHLSPLLSYGDLFFYPRCHAKFSSTVCLKEQSSVRRHVPGEQRRWPRYEFGYIFLPSRAS
RSYLVKDVRTHRRTTLSDRNNYDNEIQPTSTGSSQTKCSICHSTFRRPEHLKRHFRSHTK
EKPFECTQCGRHFSRTYTFRACFKCAVARVRCSGGTPCIRCDNRSLECQYPTERRSKAKA
RKQSSRNQDSVDGSPQEQVSRHARSPSAANTDITLALNGGKPSSQIPGYQLGQFQIQMSG
QSSSKTTSSSREHLSEHLNDPQDSRQASEPENLDLSNNSGVIDITRFPFDSYAGVNLQQL
YPQMPTSDIRATLSGDQGARLNHQVQPEIPGSNINMGMVVAHNQQLQLGFTQPYLDPAMA
STINWLSNDLLLNTTGERPTGDRPPPHSSQGGTIDSSLGQSSWLPPVISAEQTSPSLPEH
IYQTPSGNTSLGTDVDSPRHFPRDAAQSSTPQSRPCNASQRSADSYIDGGGARLPKYRRK
QDPGLRPASIVDVRFQLCPTGGPSKFSFPTIQGLREEISSEEVAFKFQIEPAMYDNIYQG
FIQLCCTENFLYSKFENKNFPPREALSHFIGLYFDSFQTVYPILHGPTFNPNSCHWLLTM
AVSAIGSYAAGIDEQDNCSAAFSEFLRRAIHTEV
Download sequence
Identical sequences B8NKQ4
XP_002381128.1.25037 5059.CADAFLAP00008993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]