SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B8P170 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8P170
Domain Number 1 Region: 150-194
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000398
Family Retrovirus zinc finger-like domains 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B8P170
Sequence length 352
Comment (tr|B8P170|B8P170_POSPM) Predicted protein {ECO:0000313|EMBL:EED85283.1} KW=Complete proteome; Reference proteome OX=561896 OS=(Poria monticola). GN=POSPLDRAFT_98199 OC=Agaricomycetes; Polyporales; Dacryobolaceae; Postia.
Sequence
MSSTLPFLDHNPTDVFNKLKAHNPEATNATDCAALEAYLSARRDYDEVVKAADEAIDHHK
RLLRQQDDRVLTELIRLDNLKVAHRFQPLLPRSIRAQHNKFIPRAIPNAYLPLPAPLPTS
AFRRPPIPSPFLQATPRSTTILADWQPNPGWTPKGSCRQCGLSQHWVRDCPDIRCTRCGK
EAPGHLEQECRTRPMKRHVSAPPEEPARHVGVVVDNVFLEGIINEAKERKERERQTKAVP
IPPPRSANPEPQASPIAGSSRPHPDTPVIFRKVDPDWTPDTTPWTWDSSWPHQEHLSGEE
WKNVGRNAHNEWFDEEEDDGVDWELYGDGEHLHNGVRAHFVSGIVPLHFFLY
Download sequence
Identical sequences B8P170
XP_002469410.1.31404 104341.JGI98199 jgi|Pospl1|98199|fgenesh3_pg.7__40

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]