SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B8P1C8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8P1C8
Domain Number 1 Region: 183-227
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000164
Family Retrovirus zinc finger-like domains 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B8P1C8
Sequence length 361
Comment (tr|B8P1C8|B8P1C8_POSPM) Predicted protein {ECO:0000313|EMBL:EED85307.1} KW=Complete proteome; Reference proteome OX=561896 OS=(Poria monticola). GN=POSPLDRAFT_98310 OC=Agaricomycetes; Polyporales; Dacryobolaceae; Postia.
Sequence
MSSTLPFLDQFNTPSTEGGKRISIYTPKHTHVGDSALLTLLLSNPTDVFNKLKTHHPEAT
NATNRAALEAHLSARHEYDEAVKAADEAINHHKRLLRQQDDRVLTELIQLDNLKVAHRFQ
PLLLRSIRAQHNKFIPRAIPNAYLPLPAPLPMSAFRRPPILSPFLQATPWSTTILADWQP
NPGWTPKGSCRRCGSSRHWVRDCPDVRCTGCGKEAPGHLERECGTRPMKRHVSAPPEEPA
RRVGVVVDNVFLEGIINEVKERKERERQTKAVPIPPPHSANPEPPASPVAGPSRPRPDTP
VVFRKVDPDWTPDTTQWTWDSSWLRQKHLEWKNLGRNAHNEWFDEEEDDGVDWELYGNGE
Q
Download sequence
Identical sequences B8P1C8
jgi|Pospl1|98310|fgenesh3_pg.7__151 XP_002469434.1.31404 104341.JGI98310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]