SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B8P9D9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8P9D9
Domain Number 1 Region: 163-207
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000239
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B8P9D9
Sequence length 435
Comment (tr|B8P9D9|B8P9D9_POSPM) Predicted protein {ECO:0000313|EMBL:EED82551.1} KW=Complete proteome; Reference proteome OX=561896 OS=(Poria monticola). GN=POSPLDRAFT_98588 OC=Agaricomycetes; Polyporales; Dacryobolaceae; Postia.
Sequence
MSSTLSFLDQFNAPSTEGGKRLSIYTPKHTHLKAHNPEATNATDRAALEAYLSARREYDE
AVKAADEAIDHHKRLLRQQDDRVLTELIRLDNLKVAHRFQPLLPRSIRAQHNKFIPRAIP
NAYLPLPAPLPTSALRCPPIPPPFLQATPRSTTIPADWQPNPGWTPKGSCRRCGSSRHWV
RDCPDVRCAGCGKEAPGHLERECGTRPMKRHVSAPPEEPARRVGVVVDNAAARRGKCSAF
EIWSALSGDRAAFPIVEMLRLSPHPDRSGSVAETSPSCSPTAPDRSSPCAWLAERTFGDY
VSWRECTAGTEMNAAFHMCCCAIWVYFWPGWFLRWVDDARRTAGRGVVLVLRCQALVLCS
VWLWHPGLLAARENLTSCACVRAFWWRTVLATRQRGVSAPHANYGTWEHLAFKPLLSMDT
IVPLHTAAPYQFESP
Download sequence
Identical sequences B8P9D9
jgi|Pospl1|98588|fgenesh3_pg.53__89 XP_002472294.1.31404 104341.JGI98588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]