SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B8PLE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B8PLE2
Domain Number - Region: 29-64
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00192
Family Retrovirus zinc finger-like domains 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B8PLE2
Sequence length 279
Comment (tr|B8PLE2|B8PLE2_POSPM) Predicted protein {ECO:0000313|EMBL:EED78303.1} KW=Complete proteome; Reference proteome OX=561896 OS=(Poria monticola). GN=POSPLDRAFT_106043 OC=Agaricomycetes; Polyporales; Dacryobolaceae; Postia.
Sequence
MTRLELKWQVTTGSIIGSNLAATSSATAFVTKSHGNSSKPRKTCSNCNMTGHEIADCFQL
GGAMEGKCAEVLTTKCPCLDKGKSGGSKVLHDPDGRMFMLSNTGDTMYIDTTASMASSSA
AKAPSTKFASLTVDTPDPVDLWAFPTLSPADTFKYSTLTRSLTDEDTASVDWGHHSSTAS
VTALATAAPAAAAALGTAPFFFDFSASTHLSPCKDNFSDLVAIAPHGIRGINGSVIYMHG
VSTIVLAIPIIALSLTWLRPTFYQGVNELCNSWDWCMWT
Download sequence
Identical sequences A0A1X6MJ47 B8PLE2
jgi|Pospl1|106043|fgenesh3_pg.220__10 104341.JGI106043 XP_002476493.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]